PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g043170m
Common NameCISIN_1g043170mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family SRS
Protein Properties Length: 143aa    MW: 16073.8 Da    PI: 8.236
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g043170mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70284.52.5e-2676128658
             DUF702   6 asCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaa 58 
                         +C+dCGn+ak+ C+++RCRtCCk+r fdC+thv+stWvpaakrr++ +  + 
  orange1.1g043170m  76 RACRDCGNRAKRACSFRRCRTCCKTRRFDCTTHVRSTWVPAAKRRQKTKLITG 128
                        58********************************************9877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051427.5E-2476126IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.6E-2278119IPR006510Zinc finger, lateral root primordium type 1
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MLNLRDIIFV APPPQPPSIS SDHHHQDGDD DDDNDRNTSN LHKTGFWGLK KWQEESHTDV  60
EGASDDHDGD HSGLMRACRD CGNRAKRACS FRRCRTCCKT RRFDCTTHVR STWVPAAKRR  120
QKTKLITGGS SSVLSFSTTA SCQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015381404.11e-104PREDICTED: protein SHI RELATED SEQUENCE 6
RefseqXP_006494070.11e-104PREDICTED: protein SHI RELATED SEQUENCE 6
TrEMBLA0A067DF281e-103A0A067DF28_CITSI; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM119592332
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.14e-08Lateral root primordium (LRP) protein-related